PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00349.1.p
Common NameEUGRSUZ_J00349, LOC104421203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 300aa    MW: 31513.8 Da    PI: 6.9631
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00349.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.43.2e-081358346
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      +W++e d+ + +a + +       W+++a+ ++ g+tl+++k+++ +
  Eucgr.J00349.1.p 13 SWSKEQDKAFENALATHFEVspdWWEKVASDVP-GKTLEEIKLHYED 58
                      7****************7448889*********.***********76 PP

2Myb_DNA-binding43.86e-14122166347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  Eucgr.J00349.1.p 122 AWTEEEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                       6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.795964IPR017884SANT domain
SMARTSM007171.4E-51062IPR001005SANT/Myb domain
SuperFamilySSF466893.18E-81267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-41360IPR009057Homeodomain-like
CDDcd001671.88E-71360No hitNo description
PfamPF002491.2E-51359IPR001005SANT/Myb domain
PROSITE profilePS5129419.333114171IPR017930Myb domain
SuperFamilySSF466895.45E-17117172IPR009057Homeodomain-like
SMARTSM007177.6E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.8E-17119169IPR006447Myb domain, plants
CDDcd001672.41E-10122167No hitNo description
Gene3DG3DSA:1.10.10.603.1E-11122165IPR009057Homeodomain-like
PfamPF002498.1E-12122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MTVDEAVSPS CSSWSKEQDK AFENALATHF EVSPDWWEKV ASDVPGKTLE EIKLHYEDLV  60
EDVNRIEAGR VPLPSYSSAC SDGSASNLGE EESGKKGGGG SGESNQGGKG SRSDQERRKG  120
IAWTEEEHRL FLLGLDKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL SSVNKDRRRS  180
SIHDITTVGS GDLSAPQGPI TGQNQTDGSA GGVSSGKSNK QSPQSPAVTS GVAVSGPPPS  240
IGQPVGGPFV SAVGTPVNLS TAPHMAYGVR GQVQGTVVPG APINMGSVTY PMPHASAHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1514781175RADIALIS
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00349.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031380.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_010031381.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-63DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A059ABA10.0A0A059ABA1_EUCGR; Uncharacterized protein
STRINGGLYMA07G28310.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-100MYB family protein